PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF071400020CFD_t1
Common NameTRAES_3BF071400020CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 307aa    MW: 34010.9 Da    PI: 5.2214
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF071400020CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-172067148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEde+l++ + ++G+g+W++++r  g+ R++k+c++rw +yl
  TRAES3BF071400020CFD_t1 20 RGLWSPEEDEKLYNHIIRYGNGCWSSVPRLAGLERCGKSCRLRWINYL 67
                             788*******************************************97 PP

2Myb_DNA-binding50.35.6e-1673116146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++
  TRAES3BF071400020CFD_t1  73 RGSFSQQEEDLIVSLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 116
                              899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-241370IPR009057Homeodomain-like
PROSITE profilePS5129417.7511567IPR017930Myb domain
SuperFamilySSF466892.73E-2817114IPR009057Homeodomain-like
SMARTSM007171.5E-121969IPR001005SANT/Myb domain
PfamPF002494.0E-152067IPR001005SANT/Myb domain
CDDcd001671.69E-112367No hitNo description
PROSITE profilePS5129424.90868122IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2571122IPR009057Homeodomain-like
SMARTSM007176.5E-1572120IPR001005SANT/Myb domain
PfamPF002493.1E-1473116IPR001005SANT/Myb domain
CDDcd001674.38E-1175115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGREAAAAVA CSSNKPKLRR GLWSPEEDEK LYNHIIRYGN GCWSSVPRLA GLERCGKSCR  60
LRWINYLRPD LKRGSFSQQE EDLIVSLHKI LGNRWSQIAS QLPGRTDNEI KNFWNSCIKK  120
KLRQQRIDPT THESLNDAAA VAEPHDKCKQ LVPAAEDGCF GGSVGSDDFL APHSPVDCSF  180
DPMSVTNVPA MRMQGSYSLC DYAGVGSDAT TYSAYTGGGD SSSNSNGTGT GTWTCGNVEP  240
LPHMDMFRDD AEPYPFDPTK FSPWHQQQPP DDDRGSAVFP IRSLSRDLPE SCFELARGAL  300
EDEFDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30161223108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968898.11e-142PREDICTED: myb-related protein Hv33-like
RefseqXP_004968899.11e-142PREDICTED: myb-related protein Hv33-like
SwissprotP200275e-77MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A077S0650.0A0A077S065_WHEAT; Uncharacterized protein
STRINGMLOC_6156.21e-179(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-70myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]